Online Purchasing Account You are logged on as Guest. LoginRegister a New AccountShopping cart (Empty)
United States 

PDKtide (biotinylated)

Protein kinase substrate
 
BML-P251-0100 100 µg 222.00 USD
Do you need bulk/larger quantities?
 
This peptide, Biotin-Ahx[protein fragment, 39 aa], is derived from AKT1 and PKN2/PRK2. It is a substrate for PDK1, CDK9/Cyclin T1 and JAK2.The biotin allows peptide to be used in kinase assays with streptavidin-bound membranes.

Product Details

Sequence:Biotin-Ahx-Lys-Thr-Phe-Cys-Gly-Thr-Pro-Glu-Tyr-Leu-Ala-Pro-Glu-Val-Arg-Arg-Glu-Pro-Arg-Ile-Leu-Ser-Glu-Glu-Glu-Gln-Glu-Mez-Phe-Arg-Asp-Phe-Asp-Tyr-Ile-Ala-Asp-Trp-Cys
 
MW:5109.6
 
Purity:≥95%
 
Shipping:Blue Ice
 
Long Term Storage:-20°C
 
Regulatory Status:RUO - Research Use Only