| ALX-210-853-C200 | 200 µg | 462.00 USD |  |
||
| Do you need bulk/larger quantities? | |||||
| Alternative Name: | TLR5, Toll/Interleukin-1 receptor-like gene 3, TIL3 |
| Host: | Goat |
| Immunogen: | Synthetic peptide corresponding to aa 151-181 (D151LSKNQIRSLYLHPSFGKLNSLKSIDFSSNQ181) of human TLR5 (Toll-like receptor 5). |
| UniProt ID: | O60602 |
| Species reactivity: | Human |
| Applications: | ELISA, Flow Cytometry, IHC, WB |
| Recommended Dilutions/Conditions: | ELISA (1:37,500) Western Blotting (1:50) IHC (1:250) Flow Cytometry (1:200) Suggested dilutions/conditions may not be available for all applications. Optimal conditions must be determined individually for each application. |
| Purity Detail: | Epitope-affinity purified IgG. |
| Quality Control: | Immunocytochemistry on human peripheral blood leukocytes. |
| Formulation: | Affinity purified antibody in 10 mM KHPO4, 140 mM NaCl, BSA @ 1mg/ml and 0.1% sodium azide. |
| Handling: | For maximum product recovery after thawing, centrifuge the vial before opening the cap. Avoid freeze/thaw cycles. After opening, prepare aliquots and store at -20°C. |
| Shipping: | Blue Ice |
| Short Term Storage: | +4°C |
| Long Term Storage: | -20°C |
| Scientific Background: | Note: Human Toll-like Receptor 5 (TLR5) is also described as Toll/Interleukin-1 Receptor-like Gene 3 (TIL3). |
| Regulatory Status: | RUO - Research Use Only |
