| ALX-210-638-C200 | 200 µg | 579.00 USD |  |
||
| Do you need bulk/larger quantities? | |||||
| Alternative Name: | CD284, TLR4 |
| Host: | Goat |
| Immunogen: | Synthetic peptide corresponding to aa 161-192 (L161IQSFKLPEYFSNLTNLEHLDLSSNKIQSIYC192) of the N-terminal domain of human TLR4 (Toll-like receptor 4). |
| UniProt ID: | O00206 |
| Species reactivity: | Human, Mouse |
| Applications: | ICC, IHC (PS), WB |
| Recommended Dilutions/Conditions: | Immunocytochemistry (acetone fixed cells, >1:400) Immunohistochemistry (paraffin sections, >1:250) Western Blot (>1:1,000) Suggested dilutions/conditions may not be available for all applications. Optimal conditions must be determined individually for each application. |
| Purity Detail: | Epitope-affinity purified IgG. |
| Formulation: | Liquid. In PBS containing 1mg/ml BSA and 0.1% sodium azide. |
| Handling: | For maximum product recovery after thawing, centrifuge the vial before opening the cap. Avoid freeze/thaw cycles. After opening, prepare aliquots and store at -20°C. |
| Shipping: | Blue Ice |
| Long Term Storage: | -20°C |
| Regulatory Status: | RUO - Research Use Only |
