Online Purchasing Account You are logged on as Guest. LoginRegister a New AccountShopping cart (Empty)
United States 

β-Defensin 3 (human), (recombinant)

 
ENZ-PRT197-0020 20 µg 262.00 USD
 
ENZ-PRT197-0100 100 µg 1,052.00 USD
Do you need bulk/larger quantities?
 

Product Details

Alternative Name:BD-3
 
Sequence:GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK
 
MW:5.2 kDa (with 45 amino acids)
 
Source:Produced in E. coli.
 
UniProt ID:P81534
 
Formulation:Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% trifluoroacetic acid (TFA).
 
Purity:≥95% (SDS-PAGE)
 
Endotoxin Content:≤1 EU/µg (LAL)
 
Reconstitution:Reconstitute with sterile 10 mM acetic acid at 0.1 mg/mL.
 
Shipping:Ambient Temperature
 
Short Term Storage:-20°C
 
Long Term Storage:-80°C
 
Use/Stability:Reconstituted solution is stable for 3 months when stored at -20°C to -80°C and for 1 month when stored at 4°C after reconstituting as directed.
 
Handling:Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution and allow several minutes for complete reconstitution. Do not vortex. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution and store at -80°C. Avoid freeze/thaw cycles.
 
Scientific Background:β-Defensin 3 (BD-3) is a member of the defensin class of antimicrobial peptides that exert host defense responses against  bacteria, fungi and viruses through microbial membranes. Interferon-gamma stimulates BD-3 expression and is important during adaptive immunity. BD-3 activates monocytes and mast cells, and has antibacterial functions towards Gram-negative and Gram-positive bacteria. Additionally, BD-3 blocks human immunodeficiency virus type 1 (HIV-1) replication through the downregulation of CXCR4, the HIV-1 co-receptor.
 
Regulatory Status:RUO - Research Use Only
 

Product Toolbox

PRODUCT RESOURCES

Datasheet
SDS
Certificate of Analysis

RELATED PRODUCTS

By target:
Defensin
By biological activity:
Defensin Recombinant protein
By catalog section:

PRODUCT SUPPORT

FAQs
Technical Service
Customer Service