Online Purchasing Account You are logged on as Guest. LoginRegister a New AccountShopping cart (Empty)
United States 

Peptide tyrosine tyrosine polyclonal antibody

 
BML-PA1254-0100 100 µl 444.00 USD
Do you need bulk/larger quantities?
 

Product Details

Alternative Name:Peptide YY, PYY
 
Host:Rabbit
 
Immunogen:Natural pig PYY (peptide with tyrosine; HYPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2.).
 
UniProt ID:P68005
 
Source:Whole rabbit serum.
 
Species reactivity:Species independent
 
Specificity:Recognizes PYY in a wide range of species.
 
Applications:IHC, WB
 
Recommended Dilutions/Conditions:Western Blot (1:1,000, ECL)
Suggested dilutions/conditions may not be available for all applications.
Optimal conditions must be determined individually for each application.
 
Formulation:Liquid. Antiserum containing 10mM sodium azide.
 
Handling:Avoid freeze/thaw cycles.
 
Shipping:Blue Ice
 
Long Term Storage:-20°C
 
Scientific Background:Peptide tyrosine tyrosine (PYY) is a 36 amino acid peptide, originally isolated from porcine gut,  which exhibits striking sequence homology with members of the pancreatic polypeptide family, including neuropeptide tyrosine (NPY). The peptide is localised to enteroglucagon-containing (L/EG) and pancreatic (A) cells in many mammalian and nonmammalian species. PYY gene expression is upregulated by various growth factors, including growth hormone and insulin-like growth factor-1  and the physiological effects of PYY are mediated by G-protein (Gαi2) coupled Y-type receptors (‘Y2 receptors of a PYY-preferring subtype’). Various actions have been reported for PYY, including the inhibition of upper intestinal and exocrine pancreatic secretion, small intestinal water flux and as the mediator for the fat-induced ileal brake. The infusion of normal post-prandial concentrations of PYY[3-36] into human volunteers has been shown to significantly decrease appetite and reduce food intake, possibly via Y2R in the arcuate nucleus. This work stimulated a great deal of research activity showing that the truncated form of PYY reduced food intake in normal and obese humans and in rodents. Recently, the actions of PYY[3-36] and GLP-1[7-36] have been shown to inhibit food intake additively in humans and rats. Immunohistochemical studies on mice have shown that PYY is the earliest detectable peptide in both pancreatic islets and colonic endocrine cells, which suggest that PYY may be a useful marker for endocrine progenitor cells.
 
Regulatory Status:RUO - Research Use Only
 
Peptide tyrosine tyrosine polyclonal antibody Immunohistochemistry
Immunohistochemistry analysis: De-waxed section of Bouin-fixed fetal (14 day) rat pancreas stained with rabbit polyclonal antisera to PYY (Prod. No. BML-PA1254; panel a). Arrows indicate identical cell profiles. From Ali-Rachedi et al., 1984.
Peptide tyrosine tyrosine polyclonal antibody Immunohistochemistry
Immunohistochemistry analysis: De-waxed sections of Bouin-fixed fetal (14 day) rat pancreas stained with rabbit polyclonal antisera to glucagon (Prod. No. BML-GA1181; panel b). Arrows indicate identical cell profiles. From Ali-Rachedi et al., 1984.
Please mouse over
Peptide tyrosine tyrosine polyclonal antibody Immunohistochemistry Peptide tyrosine tyrosine polyclonal antibody Immunohistochemistry

Product Toolbox

PRODUCT RESOURCES

Datasheet
SDS
Certificate of Analysis

RELATED PRODUCTS

By target:
Peptide tyrosine tyrosine
By biological activity:
Peptide tyrosine tyrosine Polyclonal antibody
By catalog section:

PRODUCT SUPPORT

FAQs
Technical Service
Customer Service

Related Literature

Brochures
Essential Research Tools for Neurodegeneration & Neural Signaling
Essential Research Tools for Neurodegeneration & Neural Signaling
Download as PDF

All new literature pieces