Online Purchasing Account You are logged on as Guest. LoginRegister a New AccountShopping cart (Empty)
United States 

PDKtide (biotinylated)

Protein kinase substrate
BML-P251-0100 100 µg 192.00 USD
Do you need bulk/larger quantities?
This peptide, Biotin-Ahx[protein fragment, 39 aa], is derived from AKT1 and PKN2/PRK2. It is a substrate for PDK1, CDK9/Cyclin T1 and JAK2.The biotin allows peptide to be used in kinase assays with streptavidin-bound membranes.

Product Details

Shipping:Shipped on Blue Ice
Long Term Storage:-20°C
Regulatory Status:RUO - Research Use Only
Keep in touch

©2022 Enzo Life Sciences, Inc.,