Product Specification
Alternative Name: | TLR5, Toll/Interleukin-1 receptor-like gene 3, TIL3 |
|
Host: | Goat |
|
Immunogen: | Synthetic peptide corresponding to aa 151-181 (D151LSKNQIRSLYLHPSFGKLNSLKSIDFSSNQ181) of human TLR5 (Toll-like receptor 5). |
|
UniProt ID: | O60602 |
|
Species reactivity: | Human
|
|
Applications: | Flow Cytometry, ICC, IHC (PS), WB
|
|
Recommended Dilutions/Conditions: | Immunocytochemistry (1:500) Immunohistochemistry (paraffin sections (1:250)) Suggested dilutions/conditions may not be available for all applications. Optimal conditions must be determined individually for each application. |
|
Purity Detail: | Epitope-affinity purified IgG. |
|
Quality Control: | Immunocytochemistry on human peripheral blood leukocytes. |
|
Formulation: | Liquid. In PBS containing 1mg/ml BSA and 0.1% sodium azide. |
|
Handling: | For maximum product recovery after thawing, centrifuge the vial before opening the cap. Avoid freeze/thaw cycles. After opening, prepare aliquots and store at -20°C. |
|
Shipping: | Shipped on Blue Ice |
|
Short Term Storage: | +4°C |
|
Long Term Storage: | -20°C |
|
Scientific Background: | Note: Human Toll-like Receptor 5 (TLR5) is also described as Toll/Interleukin-1 Receptor-like Gene 3 (TIL3). |
|
Regulatory Status: | RUO - Research Use Only |
|
General Literature References
Cloning and characterization of two Toll/Interleukin-1 receptor-like genes TIL3 and TIL4: evidence for a multi-gene receptor family in humans: P.M. Chaudhary, et al.; Blood
91, 4020 (1998),
Abstract;
Full Text