Online Purchasing Account You are logged on as Guest. LoginRegister a New AccountShopping cart (Empty)
United States 

Toll-like receptor 5 (human) polyclonal antibody

ALX-210-853-C200 200 µg 396.00 USD
Do you need bulk/larger quantities?

Product Details

Alternative Name:TLR5, Toll/Interleukin-1 receptor-like gene 3, TIL3
Immunogen:Synthetic peptide corresponding to aa 151-181 (D151LSKNQIRSLYLHPSFGKLNSLKSIDFSSNQ181) of human TLR5 (Toll-like receptor 5).
UniProt ID:O60602
Species reactivity:Human
Applications:Flow Cytometry, ICC, IHC (PS), WB
Recommended Dilutions/Conditions:Immunocytochemistry (1:500)
Immunohistochemistry (paraffin sections (1:250))
Suggested dilutions/conditions may not be available for all applications.
Optimal conditions must be determined individually for each application.
Purity Detail:Epitope-affinity purified IgG.
Quality Control:Immunocytochemistry on human peripheral blood leukocytes.
Formulation:Liquid. In PBS containing 1mg/ml BSA and 0.1% sodium azide.
Handling:For maximum product recovery after thawing, centrifuge the vial before opening the cap. Avoid freeze/thaw cycles. After opening, prepare aliquots and store at -20°C.
Shipping:Shipped on Blue Ice
Short Term Storage:+4°C
Long Term Storage:-20°C
Scientific Background:Note: Human Toll-like Receptor 5 (TLR5) is also described as Toll/Interleukin-1 Receptor-like Gene 3 (TIL3).
Regulatory Status:RUO - Research Use Only

General Literature References

Cloning and characterization of two Toll/Interleukin-1 receptor-like genes TIL3 and TIL4: evidence for a multi-gene receptor family in humans: P.M. Chaudhary, et al.; Blood 91, 4020 (1998), Abstract; Full Text

Product Toolbox


Certificate of Analysis


By target:
By biological activity:
TLR Polyclonal antibody
TLR5 Polyclonal antibody
By catalog section:


Technical Service
Customer Service

Recommend this page

Keep in touch

©2021 Enzo Life Sciences, Inc.,