Online Purchasing Account You are logged on as Guest. LoginRegister a New AccountShopping cart (Empty)
United States 

Toll-like receptor 4 polyclonal antibody

 
ALX-210-638-C200 200 µg 563.00 USD
Do you need bulk/larger quantities?
 

Product Details

Alternative Name:CD284, TLR4
 
Host:Goat
 
Immunogen:Synthetic peptide corresponding to aa 161-192 (L161IQSFKLPEYFSNLTNLEHLDLSSNKIQSIYC192) of the N-terminal domain of human TLR4 (Toll-like receptor 4).
 
UniProt ID:O00206
 
Species reactivity:Human, Mouse
 
Applications:ICC, IHC (PS), WB
 
Recommended Dilutions/Conditions:Immunocytochemistry (acetone fixed cells, >1:400)
Immunohistochemistry (paraffin sections, >1:250)
Western Blot (>1:1,000)
Suggested dilutions/conditions may not be available for all applications.
Optimal conditions must be determined individually for each application.
 
Purity Detail:Epitope-affinity purified IgG.
 
Formulation:Liquid. In PBS containing 1mg/ml BSA and 0.1% sodium azide.
 
Handling:For maximum product recovery after thawing, centrifuge the vial before opening the cap. Avoid freeze/thaw cycles. After opening, prepare aliquots and store at -20°C.
 
Shipping:Shipped on Blue Ice
 
Long Term Storage:-20°C
 
Regulatory Status:RUO - Research Use Only
 
Toll-like receptor 4 polyclonal antibody Immunohistochemistry
Figure 1: Immunohistochemistry of human TLR4 on paraffin section of human tonsil using to Toll-like Receptor 4 (Prod. No. ALX-210-638)."
Toll-like receptor 4 polyclonal antibody Immunohistochemistry
Figure 2: Immunohistochemistry of mouse TLR4 on paraffin section of mouse spleen using to Toll-like Receptor 4 (Prod. No. ALX-210-638)."
Please mouse over
Toll-like receptor 4 polyclonal antibody Immunohistochemistry Toll-like receptor 4 polyclonal antibody Immunohistochemistry

Product Literature References

Heme oxygenase-1 protects rat liver against warm ischemia/reperfusion injury via TLR2/TLR4-triggered signaling pathways: H.F. Huang, et al.; World J. Gastroenterol. 21, 2937 (2015), Application(s): Western Blotting, Abstract; Full Text

Product Toolbox

PRODUCT RESOURCES

Datasheet
SDS
Certificate of Analysis

RELATED PRODUCTS

By target:
TLR
TLR4
By biological activity:
TLR Polyclonal antibody
TLR4 Polyclonal antibody
By catalog section:

PRODUCT SUPPORT

FAQs
Technical Service
Customer Service