Online Purchasing Account You are logged on as Guest. LoginRegister a New AccountShopping cart (Empty)
United States 

Toll-like receptor 4 polyclonal antibody

ALX-210-638-C200 200 µg 501.00 USD
Do you need bulk/larger quantities?

Product Details

Alternative Name:CD284, TLR4
Immunogen:Synthetic peptide corresponding to aa 161-192 (L161IQSFKLPEYFSNLTNLEHLDLSSNKIQSIYC192) of the N-terminal domain of human TLR4 (Toll-like receptor 4).
UniProt ID:O00206
Species reactivity:Human, Mouse
Applications:ICC, IHC (PS), WB
Recommended Dilutions/Conditions:Immunocytochemistry (acetone fixed cells, >1:400)
Immunohistochemistry (paraffin sections, >1:250)
Western Blot (>1:1,000)
Suggested dilutions/conditions may not be available for all applications.
Optimal conditions must be determined individually for each application.
Purity Detail:Epitope-affinity purified IgG.
Formulation:Liquid. In PBS containing 1mg/ml BSA and 0.1% sodium azide.
Handling:For maximum product recovery after thawing, centrifuge the vial before opening the cap. Avoid freeze/thaw cycles. After opening, prepare aliquots and store at -20°C.
Shipping:Shipped on Blue Ice
Long Term Storage:-20°C
Regulatory Status:RUO - Research Use Only
Toll-like receptor 4 polyclonal antibody Immunohistochemistry
Figure 1: Immunohistochemistry of human TLR4 on paraffin section of human tonsil using to Toll-like Receptor 4 (Prod. No. ALX-210-638)."
Toll-like receptor 4 polyclonal antibody Immunohistochemistry
Figure 2: Immunohistochemistry of mouse TLR4 on paraffin section of mouse spleen using to Toll-like Receptor 4 (Prod. No. ALX-210-638)."
Please mouse over
Toll-like receptor 4 polyclonal antibody Immunohistochemistry Toll-like receptor 4 polyclonal antibody Immunohistochemistry

Product Literature References

Heme oxygenase-1 protects rat liver against warm ischemia/reperfusion injury via TLR2/TLR4-triggered signaling pathways: H.F. Huang, et al.; World J. Gastroenterol. 21, 2937 (2015), Application(s): Western Blotting, Abstract; Full Text

Product Toolbox


Certificate of Analysis


By target:
By biological activity:
TLR Polyclonal antibody
TLR4 Polyclonal antibody
By catalog section:


Technical Service
Customer Service

Recommend this page

Keep in touch

©2022 Enzo Life Sciences, Inc.,