Online Purchasing Account You are logged on as Guest. LoginRegister a New AccountShopping cart (Empty)
United States 

PDKtide (biotinylated)

Protein kinase substrate
BML-P251-0100 100 µg 174.00 USD
Do you need bulk/larger quantities?
This peptide, Biotin-Ahx-KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC, is derived from AKT1 and PKN2/PRK2. It is a substrate for PDK1, CDK9/Cyclin T1 and JAK2.The biotin allows peptide to be used in kinase assays with streptavidin-bound membranes.

Product Specification

Shipping:Shipped on Blue Ice
Long Term Storage:-20°C

Related Literature

Diabetes Catalog
Diabetes Catalog
Download as PDF

Technical Posters
Disease-Associated Stress Signaling
Disease-Associated Stress Signaling
Download as PDF

All new literature pieces

Recommend this page

For Research Use Only. Not for use in diagnostic procedures.
Keep in touch

©2017 Enzo Life Sciences, Inc.,