Online Purchasing Account You are logged on as Guest. LoginRegister a New AccountShopping cart (Empty)
United States 


Protein kinase substrate
BML-P250-0100 100 µg 170.00 USD
Do you need bulk/larger quantities?
This peptide, [protein fragment, 39 aa], is derived from AKT1 and PKN2/PRK2. It is a substrate for PDK1, CDK9/Cyclin T1 and JAK2.

Product Specification

Shipping:Shipped on Blue Ice
Long Term Storage:-20°C

Related Literature

Diabetes Catalog
Diabetes Catalog
Download as PDF

All new literature pieces

Recommend this page

For Research Use Only. Not for use in diagnostic procedures.
Keep in touch

©2019 Enzo Life Sciences, Inc.,