Online Purchasing Account You are logged on as Guest. LoginRegister a New AccountShopping cart (Empty)
United States 

PDKtide

Protein kinase substrate
 
BML-P250-0100 100 µg 162.00 USD
Do you need bulk/larger quantities?
 
This peptide, [protein fragment, 39 aa], is derived from AKT1 and PKN2/PRK2. It is a substrate for PDK1, CDK9/Cyclin T1 and JAK2.

Product Specification

Sequence:H-Lys-Thr-Phe-Cys-Gly-Thr-Pro-Glu-Tyr-Leu-Ala-Pro-Glu-Val-Arg-Arg-Glu-Pro-Arg-Ile-Leu-Ser-Glu-Glu-Glu-Gln-Glu-Met-Phe-Arg-Asp-Phe-Asp-Tyr-Ile-Ala-Asp-Trp-Cys-OH
 
MW:4770.1
 
Purity:≥95%
 
Shipping:Shipped on Blue Ice
 
Long Term Storage:-20°C
 

Related Literature

Catalogs
Diabetes Catalog
Diabetes Catalog
Download as PDF

All new literature pieces

Recommend this page

 
For Research Use Only. Not for use in diagnostic procedures.
Keep in touch

©2017 Enzo Life Sciences, Inc.,