Online Purchasing Account You are logged on as Guest. LoginRegister a New AccountShopping cart (Empty)
United States 

Toll-like receptor 5 (human) polyclonal antibody

ALX-210-853-C200 200 µg 356.00 USD
Do you need bulk/larger quantities?

Product Specification

Alternative Name:TLR5, Toll/Interleukin-1 receptor-like gene 3, TIL3
Immunogen:Synthetic peptide corresponding to aa 151-181 (D151LSKNQIRSLYLHPSFGKLNSLKSIDFSSNQ181) of human TLR5 (Toll-like receptor 5).
UniProt ID:O60602
Species reactivity:Human
Applications:Flow Cytometry, ICC, IHC (PS), WB
Recommended Dilutions/Conditions:Immunocytochemistry (1:500)
Immunohistochemistry (paraffin sections (1:250))
Suggested dilutions/conditions may not be available for all applications.
Optimal conditions must be determined individually for each application.
Purity Detail:Epitope-affinity purified IgG.
Quality Control:Immunocytochemistry on human peripheral blood leukocytes.
Formulation:Liquid. In PBS containing 1mg/ml BSA and 0.1% sodium azide.
Handling:For maximum product recovery after thawing, centrifuge the vial before opening the cap. Avoid freeze/thaw cycles. After opening, prepare aliquots and store at -20°C.
Shipping:Shipped on Blue Ice
Short Term Storage:+4°C
Long Term Storage:-20°C
Scientific Background:Note: Human Toll-like Receptor 5 (TLR5) is also described as Toll/Interleukin-1 Receptor-like Gene 3 (TIL3).

General Literature References

Cloning and characterization of two Toll/Interleukin-1 receptor-like genes TIL3 and TIL4: evidence for a multi-gene receptor family in humans: P.M. Chaudhary, et al.; Blood 91, 4020 (1998), Abstract; Full Text

Product Toolbox


Certificate of Analysis


By target:
By biological activity:
TLR Polyclonal antibody
TLR5 Polyclonal antibody
By catalog section:


Technical Service
Customer Service

Related Literature

Product Flyers
Key TLR Ligands and their Receptors
Key TLR Ligands and their Receptors
Download as PDF

All new literature pieces

Recommend this page

For Research Use Only. Not for use in diagnostic procedures.
Keep in touch

©2017 Enzo Life Sciences, Inc.,