Online Purchasing Account You are logged on as Guest. LoginRegister a New AccountShopping cart (Empty)
United States 

Toll-like receptor 5 (human) polyclonal antibody

 
ALX-210-853-C200 200 µg 374.00 USD
Do you need bulk/larger quantities?
 

Product Specification

Alternative Name:TLR5, Toll/Interleukin-1 receptor-like gene 3, TIL3
 
Host:Goat
 
Immunogen:Synthetic peptide corresponding to aa 151-181 (D151LSKNQIRSLYLHPSFGKLNSLKSIDFSSNQ181) of human TLR5 (Toll-like receptor 5).
 
UniProt ID:O60602
 
Species reactivity:Human
 
Applications:Flow Cytometry, ICC, IHC (PS), WB
 
Recommended Dilutions/Conditions:Immunocytochemistry (1:500)
Immunohistochemistry (paraffin sections (1:250))
Suggested dilutions/conditions may not be available for all applications.
Optimal conditions must be determined individually for each application.
 
Purity Detail:Epitope-affinity purified IgG.
 
Quality Control:Immunocytochemistry on human peripheral blood leukocytes.
 
Formulation:Liquid. In PBS containing 1mg/ml BSA and 0.1% sodium azide.
 
Handling:For maximum product recovery after thawing, centrifuge the vial before opening the cap. Avoid freeze/thaw cycles. After opening, prepare aliquots and store at -20°C.
 
Shipping:Shipped on Blue Ice
 
Short Term Storage:+4°C
 
Long Term Storage:-20°C
 
Scientific Background:Note: Human Toll-like Receptor 5 (TLR5) is also described as Toll/Interleukin-1 Receptor-like Gene 3 (TIL3).
 

General Literature References

Cloning and characterization of two Toll/Interleukin-1 receptor-like genes TIL3 and TIL4: evidence for a multi-gene receptor family in humans: P.M. Chaudhary, et al.; Blood 91, 4020 (1998), Abstract; Full Text

Product Toolbox

PRODUCT RESOURCES

Datasheet
MSDS
Certificate of Analysis

RELATED PRODUCTS

By target:
TLR
TLR5
By biological activity:
TLR Polyclonal antibody
TLR5 Polyclonal antibody
By catalog section:

PRODUCT SUPPORT

FAQs
Technical Service
Customer Service

Recommend this page

 
For Research Use Only. Not for use in diagnostic procedures.
Keep in touch

©2019 Enzo Life Sciences, Inc.,