Product Details
Alternative Name: | TRAIL receptor 3, DcR1, Death Receptor 1, TRID, CD263, TNFRSF 10C, TNF-related apoptosis-inducing ligand receptor 3, Tumor necrosis factor receptor superfamily member 10C |
|
Host: | Goat |
|
Immunogen: | Synthetic peptide corresponding to aa 33-63 (E33VPQQTVAPQQQRHSFKGEECPAGSHRSEHT63) of the extracellular domain of human TRAIL-R3. |
|
UniProt ID: | O14798 |
|
Gene/Protein Identifier: | 8794 (Entrez GeneID) |
|
Species reactivity: | Human
|
|
Applications: | Flow Cytometry, ICC, IHC (PS), WB
|
|
Recommended Dilutions/Conditions: | Flow Cytometry (1µl/106 cells/100µl) Immunocytochemistry (1:300),Western Blot (1:1,000) Suggested dilutions/conditions may not be available for all applications. Optimal conditions must be determined individually for each application. |
|
Application Notes: | Detects a band of ~33kDa by Western blot. |
|
Purity Detail: | Epitope-affinity purified IgG. |
|
Quality Control: | Western blot or Immunocytochemistry on cell lines HEK 293 or Jurkat. |
|
Formulation: | Liquid. In PBS containing 1mg/ml BSA and 0.1% sodium azide. |
|
Handling: | For maximum product recovery after thawing, centrifuge the vial before opening the cap. Avoid freeze/thaw cycles. After opening, prepare aliquots and store at -20°C. |
|
Shipping: | Blue Ice |
|
Long Term Storage: | -20°C |
|
Regulatory Status: | RUO - Research Use Only |
|
Figure: Specificity of PAb to TRAIL-R3. Lane 1: TRAIL-R3:Fc. Lane 2: TRAIL-R2.
ALX-210-744 recognizes an approx. 66kDa band of the expected size of the recombinant TRAIL-R3:Fc protein in lane 1 and shows no detectable cross-reactivity to TRAIL-R2:Fc in lane 2."
Please mouse over
Product Literature References
High levels of endogenous tumor necrosis factor-related apoptosis-inducing ligand expression correlate with increased cell death in human pancreas: A.D. Sanlioglu, et al.; Pancreas
36, 385 (2008),
Abstract;
Full Text
Lack of tumor necrosis factor-related apoptosis-inducing ligand but presence of its receptors in the human brain: J. Dörr, et al.; J. Neurosci.
22, RC209 (2002),
Abstract;
Full Text
Rel/NF-κB transcription factors protect against tumor necrosis factor (TNF)-related apoptosis-inducing ligand (TRAIL)-induced apoptosis by up-regulating the TRAIL decoy receptor DcR1: D. Bernard, et al.; J. Biol. Chem.
276, 27322 (2001),
Abstract;
Full Text
The cytokines tumor necrosis factor-alpha (TNF-alpha ) and TNF-related apoptosis-inducing ligand differentially modulate proliferation and apoptotic pathways in human keratinocytes expressing the human papillomavirus-16 E7 oncoprotein: J.R. Basile et al.; J. Biol. Chem.
276, 22522 (2001),
Abstract;
Full Text
Sensitivity to TRAIL/APO-2L-mediated apoptosis in human renal cell carcinomas and its enhancement by topotecan: M. Dejosez, et al.; Cell Death Differ.
7, 1127 (2000),
Abstract;
General Literature References
Characterization of two receptors for TRAIL: P. Schneider, et al.; FEBS Lett.
416, 329 (1997),
Abstract;
Cloning and characterization of TRAIL-R3, a novel member of the emerging TRAIL receptor family: M.A. Degli-Esposti, et al.; J. Exp. Med.
186, 1165 (1997),
Abstract;
Full Text
Related Products