Online Purchasing Account You are logged on as Guest. LoginRegister a New AccountShopping cart (Empty)
United States 

TRAIL-R3 (human) polyclonal antibody

 
ALX-210-744-C200 200 µg 330.00 USD
Do you need bulk/larger quantities?
 

Product Specification

Alternative Name:TRAIL receptor 3, DcR1, Death Receptor 1, TRID, CD263, TNFRSF 10C, TNF-related apoptosis-inducing ligand receptor 3, Tumor necrosis factor receptor superfamily member 10C
 
Host:Goat
 
Immunogen:Synthetic peptide corresponding to aa 33-63 (E33VPQQTVAPQQQRHSFKGEECPAGSHRSEHT63) of the extracellular domain of human TRAIL-R3.
 
UniProt ID:O14798
 
Gene/Protein Identifier:8794 (Entrez GeneID)
 
Species reactivity:Human
 
Applications:Flow Cytometry, ICC, IHC (PS), WB
 
Recommended Dilutions/Conditions:Flow Cytometry (1µl/106 cells/100µl)
Immunocytochemistry (1:300),Western Blot (1:1,000)
Suggested dilutions/conditions may not be available for all applications.
Optimal conditions must be determined individually for each application.
 
Application Notes:Detects a band of ~33kDa by Western blot.
 
Purity Detail:Epitope-affinity purified IgG.
 
Quality Control:Western blot or Immunocytochemistry on cell lines HEK 293 or Jurkat.
 
Formulation:Liquid. In PBS containing 1mg/ml BSA and 0.1% sodium azide.
 
Handling:For maximum product recovery after thawing, centrifuge the vial before opening the cap. Avoid freeze/thaw cycles. After opening, prepare aliquots and store at -20°C.
 
Shipping:Shipped on Blue Ice
 
Long Term Storage:-20°C
 
210-744
Figure: Specificity of PAb to TRAIL-R3. Lane 1: TRAIL-R3:Fc. Lane 2: TRAIL-R2. ALX-210-744 recognizes an approx. 66kDa band of the expected size of the recombinant TRAIL-R3:Fc protein in lane 1 and shows no detectable cross-reactivity to TRAIL-R2:Fc in lane 2.
Please mouse over
210-744

Product Literature References

High levels of endogenous tumor necrosis factor-related apoptosis-inducing ligand expression correlate with increased cell death in human pancreas: A.D. Sanlioglu, et al.; Pancreas 36, 385 (2008), Abstract; Full Text
Lack of tumor necrosis factor-related apoptosis-inducing ligand but presence of its receptors in the human brain: J. Dörr, et al.; J. Neurosci. 22, RC209 (2002), Abstract; Full Text
Rel/NF-κB transcription factors protect against tumor necrosis factor (TNF)-related apoptosis-inducing ligand (TRAIL)-induced apoptosis by up-regulating the TRAIL decoy receptor DcR1: D. Bernard, et al.; J. Biol. Chem. 276, 27322 (2001), Abstract; Full Text
The cytokines tumor necrosis factor-alpha (TNF-alpha ) and TNF-related apoptosis-inducing ligand differentially modulate proliferation and apoptotic pathways in human keratinocytes expressing the human papillomavirus-16 E7 oncoprotein: J.R. Basile et al.; J. Biol. Chem. 276, 22522 (2001), Abstract; Full Text
Sensitivity to TRAIL/APO-2L-mediated apoptosis in human renal cell carcinomas and its enhancement by topotecan: M. Dejosez, et al.; Cell Death Differ. 7, 1127 (2000), Abstract;

General Literature References

Characterization of two receptors for TRAIL: P. Schneider, et al.; FEBS Lett. 416, 329 (1997), Abstract;
Cloning and characterization of TRAIL-R3, a novel member of the emerging TRAIL receptor family: M.A. Degli-Esposti, et al.; J. Exp. Med. 186, 1165 (1997), Abstract; Full Text

Related Products

TRAIL-R3 polyclonal antibody 

ICC, WB | Print as PDF
 
ADI-905-216-100 100 µg 366.00 USD
Do you need bulk/larger quantities?
 

TRAIL-R3 (human) monoclonal antibody (LEIA) 

Flow Cytometry, WB | Print as PDF
 
ALX-804-136-C100 100 µg 320.00 USD
Do you need bulk/larger quantities?
 

TRAIL-R3 (human) monoclonal antibody (HS301) 

Flow Cytometry, ICC | Print as PDF
 
ALX-804-344A-C100 100 µg 360.00 USD
Do you need bulk/larger quantities?
 

TRAIL-R3 (human) monoclonal antibody (TR3.06) 

Flow Cytometry, IHC (PS), WB | Print as PDF
 
ALX-804-667-C100 100 µg 443.00 USD
Do you need bulk/larger quantities?
 

TRAIL-R3 (human) monoclonal antibody (DJR3) 

Flow Cytometry | Print as PDF
 
ALX-804-908-0100 100 µg 205.00 USD
Do you need bulk/larger quantities?
 

Product Toolbox

PRODUCT RESOURCES

Datasheet
MSDS
Certificate of Analysis

RELATED PRODUCTS

By target:
TRAIL receptor
By biological activity:
TRAIL receptor Polyclonal antibody
By catalog section:

PRODUCT SUPPORT

FAQs
Technical Service
Customer Service

Related Literature

Product Flyers
TRAIL & TRAIL Receptors
TRAIL & TRAIL Receptors
Download as PDF

All new literature pieces

Recommend this page

 
For Research Use Only. Not for use in diagnostic procedures.
Keep in touch

©2017 Enzo Life Sciences, Inc.,