Online Purchasing Account You are logged on as Guest. LoginRegister a New AccountShopping cart (Empty)
United States 

Toll-like receptor 4 polyclonal antibody

 
ALX-210-638-C200 200 µg 430.00 USD
Do you need bulk/larger quantities?
 

Product Specification

Alternative Name:CD284, TLR4
 
Host:Goat
 
Immunogen:Synthetic peptide corresponding to aa 161-192 (L161IQSFKLPEYFSNLTNLEHLDLSSNKIQSIYC192) of the N-terminal domain of human TLR4 (Toll-like receptor 4).
 
UniProt ID:O00206
 
Species reactivity:Human, Mouse
 
Applications:ICC, IHC (PS), WB
 
Recommended Dilutions/Conditions:Immunocytochemistry (acetone fixed cells, >1:400)
Immunohistochemistry (paraffin sections, >1:250)
Western Blot (>1:1,000)
Suggested dilutions/conditions may not be available for all applications.
Optimal conditions must be determined individually for each application.
 
Purity Detail:Epitope-affinity purified IgG.
 
Formulation:Liquid. In PBS containing 1mg/ml BSA and 0.1% sodium azide.
 
Handling:For maximum product recovery after thawing, centrifuge the vial before opening the cap. Avoid freeze/thaw cycles. After opening, prepare aliquots and store at -20°C.
 
Shipping:Shipped on Blue Ice
 
Long Term Storage:-20°C
 
210-638 human
Figure 1: Immunohistochemistry of human TLR4 on paraffin section of human tonsil using to Toll-like Receptor 4 (Prod. No. ALX-210-638).
210-638 mouse
Figure 2: Immunohistochemistry of mouse TLR4 on paraffin section of mouse spleen using to Toll-like Receptor 4 (Prod. No. ALX-210-638).
Please mouse over
210-638 human 210-638 mouse

Product Literature References

Heme oxygenase-1 protects rat liver against warm ischemia/reperfusion injury via TLR2/TLR4-triggered signaling pathways: H.F. Huang, et al.; World J. Gastroenterol. 21, 2937 (2015), Application(s): Western Blotting, Abstract; Full Text

Product Toolbox

PRODUCT RESOURCES

Datasheet
MSDS
Certificate of Analysis

RELATED PRODUCTS

By target:
TLR
TLR4
By biological activity:
TLR Polyclonal antibody
TLR4 Polyclonal antibody
By catalog section:

PRODUCT SUPPORT

FAQs
Technical Service
Customer Service

Related Literature

Product Flyers
Key TLR Ligands and their Receptors
Key TLR Ligands and their Receptors
Download as PDF

All new literature pieces

Recommend this page

 
For Research Use Only. Not for use in diagnostic procedures.
Keep in touch

©2017 Enzo Life Sciences, Inc.,