Product Details
Alternative Name: | CD284, TLR4 |
|
Host: | Goat |
|
Immunogen: | Synthetic peptide corresponding to aa 161-192 (L161IQSFKLPEYFSNLTNLEHLDLSSNKIQSIYC192) of the N-terminal domain of human TLR4 (Toll-like receptor 4). |
|
UniProt ID: | O00206 |
|
Species reactivity: | Human, Mouse
|
|
Applications: | ICC, IHC (PS), WB
|
|
Recommended Dilutions/Conditions: | Immunocytochemistry (acetone fixed cells, >1:400) Immunohistochemistry (paraffin sections, >1:250) Western Blot (>1:1,000) Suggested dilutions/conditions may not be available for all applications. Optimal conditions must be determined individually for each application. |
|
Purity Detail: | Epitope-affinity purified IgG. |
|
Formulation: | Liquid. In PBS containing 1mg/ml BSA and 0.1% sodium azide. |
|
Handling: | For maximum product recovery after thawing, centrifuge the vial before opening the cap. Avoid freeze/thaw cycles. After opening, prepare aliquots and store at -20°C. |
|
Shipping: | Blue Ice |
|
Long Term Storage: | -20°C |
|
Regulatory Status: | RUO - Research Use Only |
|
Figure 1: Immunohistochemistry of human TLR4 on paraffin section of human tonsil using to Toll-like Receptor 4 (Prod. No.
ALX-210-638)."
Figure 2: Immunohistochemistry of mouse TLR4 on paraffin section of mouse spleen using to Toll-like Receptor 4 (Prod. No.
ALX-210-638)."
Please mouse over
Product Literature References
The differential expression of toll like receptors and RIG-1 correlates to the severity of infectious diseases: M. Rice, et al.; Ann. Diagn. Pathol.
63, 152102 (2023),
Abstract;
Heme oxygenase-1 protects rat liver against warm ischemia/reperfusion injury via TLR2/TLR4-triggered signaling pathways: H.F. Huang, et al.; World J. Gastroenterol.
21, 2937 (2015),
Application(s): Western Blotting,
Abstract;
Full Text